SKU: 39992879994

Human CGA&TSHB protein, No tag&His tag

Sale price$112.50 Regular price$125.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 12 - Jul 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CGA&TSHB protein, No tag&His tagProduct Specification Species Human Synonyms Thyroid stimulating hormone, Thyrotropin, TSH Accession P01215P01222 Amino Acid Sequence Protein sequence1 (P01215, Ala25 Ser116) APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS; Protein sequence2 (P01222, Phe21 Val138, with C His tag) FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV Expression

Product Specification


Species Human
Synonyms Thyroid-stimulating hormone, Thyrotropin, TSH
Accession P01215、P01222
Amino Acid Sequence

Protein sequence1 (P01215, Ala25-Ser116) APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS; 

Protein sequence2 (P01222, Phe21-Val138, with C-His tag) FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSYLVGFSV

Expression System HEK293
Molecular Weight Predicted MW: 10.2 kDa(CGA)&15.2 kDa(TSHB) Observed MW: 17-20 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag (TSHB)&No tag (CGA)
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Thyroid-stimulating hormone (TSH) is a pituitary hormone that stimulates the thyroid gland to produce thyroxine (T4), and then triiodothyronine (T3) which stimulates the metabolism of almost every tissue in the body. It is a glycoprotein hormone produced by thyrotrope cells in the anterior pituitary gland, which regulates the endocrine function of the thyroid. TSH consists of two subunits, the alpha and the beta subunit. The α subunit is thought to be the effector region responsible for stimulation of adenylate cyclase (involved the generation of cAMP). The β (beta) subunit (TSHB) is unique to TSH, and therefore determines its receptor specificity. The TSH receptor is found mainly on thyroid follicular cells. Stimulation of the receptor increases T3 and T4 production and secretion.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39992879994

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 697 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
E. Ricciardi Trundy
Boise, US
★★★★★ 3
3.5 Stars -- Sturdy but Limited
Color: Purple, Size: Large (Pack of 1)
I got the Barnacle toy in size Large for my ~45 lb mutt. She enjoys food toys, and I wanted to find one sturdy enough that I felt safe leaving her with when I left for work since she tends to destroy her toys quickly. First thing -- there's no way any dog is going to be able to destroy this. The "rubber" is super thick and a good balance of flexible and sturdy, so she can't do her favorite "pick at a weak edge and slowly disembowel it" trick. I've had it for a couple months now and it looks brand new. However, it isn't great for feeding her kibble. She eats 1 cup at morning and at night, and none of the compartments fits that comfortably. I don't really feel like dividing her food into 3 portions every day to split it between either. The bigger problem is the hole size, or rather the ratio of kibble-to-hole size. The holes are very big with rubber "fingers" inside to slow the food spill. I've still found that it tends to dump a fistful of kibble all at once, or not let anything go for a long time. This may have to do with my dog's "technique", as described below. Another problem is that since this has three separate chambers, this toy is not hollow and is surprisingly heavy. While my dog has no problems throwing a kong around (and I mean THROWING a kong around), the weight and asymmetrical shape makes it difficult to throw or roll, which is my dog's preferred way to use a food toy. This toy works best when a dog slaps it with her paws or picks it up and drops it, which may be why my dog gets frustrated with getting her food from it. What this toy is really great for, for us, is high value treats. If I am leaving at an unusual time and anticipate that she's going to fuss, I can put "the good stuff" in this toy and then she doesn't mind the struggle at all! The different size chambers make this especially nice if I'm breaking up odd sized or home made treats and want her to stay busy for a while. Since it's so sturdy, she can chew on it all she wants, but she has to do the work to get the treats. All in all-- this toy isn't great for my dog's daily feedings, but it's great for high value treats and a change of pace.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2015
W
Verified Purchase
Write Reviews
Boise, US
★★★★★ 5
Actually a challenge for my genius dog!
Color: Purple, Size: Large (Pack of 1)
I am pretty sure my dog owns every puzzle toy and treat-dispensing dog toy that exists, and he's able to figure most of them out in less than 5 minutes. Many last no more than 60 seconds before he's solved them. The Barncle, however, is actually a challenge for him! The Barnacle has three "compartments, " none of which are connected. All three have a rubber "mouth" that helps keep treats inside. The rubber "mouth parts" are very effective and make it quite challenging to get treats out once they've been placed inside. You can trim the rubber "mouth parts" to make it easier to let treats out, but I'm not doing that. I'm glad that it's not challenge! The Barnacle keeps my dog occupied for at least 30 minutes, which is a LONG time for my dog who usually has a "What next?" attitude towards toys. Th only "bad" thing about the Barnacle is that it's so hard to get treats out of, even for humans. Therefore, it could attract vermin if you're not careful to clean it out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2025
V
Verified Purchase
Vanessa
San Leandro, US
★★★★★ 1
OMG - DO NOT BUY - it smells like noxious poison.
Color: Purple, Size: Medium (Pack of 1), Color: Purple, Size: Medium (Pack of 1)
OMG DO NOT BUY!!!!!!!!!!! I didn’t think the reviews stating the noxious smell could be accurate - OMG OUR WHOLE HOUSE REEKS OF POISON. I LITERALLY FEEL LIKE I MAY BE SICK. OMG OMG OMG.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
K
Verified Purchase
KM
Louisville, US
★★★★★ 5
Great toy for dispensing dinner!
Color: Purple, Size: Large (Pack of 1)
This is one of my puppy's favorite toys! We always try to use toys to dispense his meals, but many of them become too easy for him. Kongs take no time at all to empty. This one seems to provide much more of a challenge, mostly due to the three different sizes of compartments and openings. He'll empty the largest compartment fairly quickly, but the small one almost always has a piece or two of kibble that he just can't get out. This helps to keep him interested in the toy throughout the day. We use a large breed dog food with larger sized kibble which helps to add to the challenge. The fact that this bounces erratically and doesn't roll smoothly makes it difficult for my dog to develop a method for emptying it quickly. With some other toys, like the Kong Wobbler, he quickly learns to just push it around with his nose. This toy makes him work much harder! The construction of this toy is very sturdy. We usually feed one meal a day in this, and it's held up well to heavy chewing. I (and my roommates) appreciate that it's made of softer plastic which doesn't make as much noise on the hardwood floors as some of his other toys. The prongs on the openings can be cut to adjust the difficulty, which is nice if you're using different sized kibble or treats. It is a little harder to fill than other toys, but still not terribly difficult. Overall I've had a great experience with all the PetSafe toys I've tried, and this one is one of the very best!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2015
D
Verified Purchase
DEVIN
Waukegan, US
★★★★★ 5
Great chew toys!
Color: Purple, Size: Medium (Pack of 1), Color: Purple, Size: Medium (Pack of 1)
Keenan LOVES this toy! He will play with it all day. Running around the house, chasing as it bounces in different directions. And he'll be so content chewing on it for long periods of time. It makes an annoying sound when he chews, but I can live with it if it's keeping him entertained. This is the second purple rubber toy from this brand that I've purchased, the other being the squirrel one, which was his favorite until I purchased this for Christmas. They are super durable, his squirrel is still going strong. Even without putting food/treats inside, these are great toys for dogs that enjoy the softer rubber type chew toys. My only con is that it's a little big for him. He weighs 70lbs and I got the medium. It's fine but he has a hard time carrying it because of its size/shape, and he can't catch it when I toss it to him. Think I'm gonna buy the small size to see if it's any better.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2021

recommand products